SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002687965.2.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002687965.2.76553
Domain Number 1 Region: 389-625
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.74e-36
Family Calponin-homology domain, CH-domain 0.0000901
Further Details:      
 
Domain Number 2 Region: 86-241,387-436
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.77e-16
Family FAD/NAD-linked reductases, N-terminal and central domains 0.058
Further Details:      
 
Domain Number 3 Region: 756-789
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000153
Family LIM domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002687965.2.76553
Sequence length 1960
Comment PREDICTED: protein-methionine sulfoxide oxidase MICAL3 isoform X12 [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MEESKNEATNRAHVLFDRFVQATTCKGTLKAFQELCDHLELKPKDHRSFYHKLKSKLNYW
KAKALWAKLDKRGSHKDYKKGKVCTNTKCLIIGAGPCGLRTAIDLSLLGAKVVVIEKRDA
FSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGAIDHISIRQLQLILLKVALILGIEIHVN
VEFRGLVEPPEDQENERIGWRALVHPKTHPVSEYEFEVIIGGDGRRNTLEGFRRKEFRGK
LAIAITANFINRNTTAEAKVEEISGVAFIFNQKFFQELREATGIDLENIVYYKDDTHYFV
MTAKKQSLLDKGVILHDYADTELLLSRENVDQEALLSYAREAADFSTQQQLPSLDFAINH
YGQPDVAMFDFTCMYASENAALVREHNGHQLLVALVGDSLLEPFWPMGTGIARGFLAAMD
SAWMVRSWSLGTSPLEVLAERESIYRLLPQTTPENVSKNFSQYSIDPVTRYPNVNVNFLR
PSQVRHLYDTGDTKDVHLEMENLVNSRTTPKLARNESVARSSKLLGWCQRQTDGYAGVNV
TDLTMSWKSGLALCAIIHRYRPDLIDFDSLDEQNVEKNNQLAFDIAEKELGISPIMTGRE
MASVGEPDKLSMVMYLTQFYEMFKDSLPSRDASDLNAEERAVLIASTKSPISFLSKLGQT
ISRKRSPKDKKEKDLDGAGKRRKTSQSEEEDTPRGHRGARPTLVSTLTDRRMDVALGNQN
KVKYMATQLLAKFEENAPPQSVGVRRQGSIKKEFPQNLGGSDTCYFCQKRVYVMERLSAE
GKFFHRSCFKCEHCATTLRLSAYAYALEDGKFYCKPHYCYRLSGPAQRKRPAGVPLSGKE
ARGPLQDSPAADASGRPSTSASPAERSPGPSVNGLEEPSVAKRLRGTPERIELENYRLSV
RQAEGLEEVPEETQAEHNLSSVLDTGTEEDAASSSSESEMEEEEPPLPTSDLGGVPWKEA
VRIHALLRGKSEEELEASRSFGAGEEEEEDEEDEEEEEEEEDEEDEEEDEDESSEVGSPR
RLQQLLNPADPLEIQADVHWTHIRESQEERAALAPKSPLPGVPFDEDDLERDVDSEPAEI
KGEAAENGDAGDTGAELDDDQHWSDDVPSEANTELHLPAVGAELELRVSDGEEEPPPASV
GHPERGPSRVSSPTRSPEEPTGLSSPARSPGAQSAHPPLAAVATGVRSPAESPLPEPSTP
PAEPEAHPPIRSQPEARTPPSPASPQRPSPPTQLPICSQPQPSPEATVPSPTLSPIRSQP
VPARTSTPLAPLPVKNQGVTKDTLGSSLPGDEALKRSDLVAEFWMKSAEIRRSLGLTPVH
RSPGSELAFQSPPLKACPAEKAPQSEGLRLLKPPPVPRKLGLPAAEGAQPCPPTPVSPPD
REPKGPREEHRDLSSSSGLGLQGSSSRTRTPGSQSFNTSDSTMLTPPSSPPPPPPDEEPA
TLHRKPALAGQLVASAPPPPAVCVRPPREPTQPPQEEARKSFVESVDEIPFADDVEDTYD
DNTCDDRTEDSSLQETFFTPPSHWPHPKQPLAPENGRGPESAVPLQKRGLPLVSAEAKEL
AAERMRAREKSVRSQALRDAMARQLSRMKEMDIAAAAPRTPRTPAPRRATAVPPKGPEEP
APRHEATSEELLSPPSDSGGPDGSVTSSEGSSGKSKKRSSLFSPRRSKKEKKPKGEGRPL
ERPSPGTLEEAAAKPRSLWKSVFSGYRKDKKKSDGRSCPSTPSSGTTVDAGKPRASPVSR
AELRTRRQLSCSEDSDLSSDDVLERTSQKSRKEPRTYTEEELNAKLTRRVQKAARRQAKQ
EELKRLHRAQIIQRQLEQVEEKQRQLEERGVAVEKALRGEAGMGKKDDPKLMQEWFKLVQ
EKNAMVRYESELMIFARELELEDRQSRLQQELRERMAVEDHLKTEEELAEEKRILNEMLE
VVEQRDALVALLEEQRLREKEEDKDLEAAMLSKGFSLHWS
Download sequence
Identical sequences G3MWR8
XP_002687965.2.76553 XP_015319081.1.59421 ENSBTAP00000053971 ENSBTAP00000053971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]