SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002689719.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002689719.1.76553
Domain Number 1 Region: 117-203
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 9.78e-47
Family variant PHD-like domain 0.0000154
Further Details:      
 
Domain Number 2 Region: 195-276
Classification Level Classification E-value
Superfamily EF-hand 0.0000141
Family EF-hand modules in multidomain proteins 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002689719.1.76553
Sequence length 400
Comment PREDICTED: PHD finger protein 24 [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MGVLMSKRQTVEQVQKVSLAVSAFKDGLRDRPSIRRTGELPGSRRGTVEGSVQEVQEEKE
AEASAPALQEESSVNRASWERLRDGRGVEPEEFDRTSHFTPPAFIRPTRKLDDDKPPDIR
LEPREPVVNDEMCDVCEVWTAESLFPCRVCTRVFHDGCLRRMGYIQGDSAAEVTETAHTE
TGWSCHYCDNLNLLLTEEEMYSLTETFQQCKVIPDCSLTLEDFLRYRHQTAKRGNSDRAL
SEEQEEQAARQFAALDPEHRGHVEWPDFLSHESLLLLQQLRPQNSLLRLLTVKERERARA
TFLARGSGSTISEAECHRAQHSWFCKRPIEAPSCSVSVSHVGPIADSSPASSSSKSQDKA
PLPTEPESRFVDWPTFLQESVIYILAARPNSLAIHLKPPG
Download sequence
Identical sequences E1BJ48 L8I8N0
XP_002689719.1.76553 XP_005199269.1.59421 XP_005210188.1.76553 XP_005900816.1.15283 XP_019821674.1.53367 XP_872105.3.59421 ENSBTAP00000017015 9913.ENSBTAP00000017015 ENSBTAP00000017015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]