SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002697643.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002697643.1.76553
Domain Number 1 Region: 55-86
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000345
Family CHHC finger 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002697643.1.76553
Sequence length 340
Comment PREDICTED: U11/U12 small nuclear ribonucleoprotein 48 kDa protein [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MEAELPPVEERRRLREELSEFVESCRRTLEEVTASLGWSLDRLEPGEEAAAAEDEVAICP
YDSNHHMPRSSLAKHMMSCRLRRLGYTKEEEDKMYNSDFFYENANVPSITLNKDSQFQII
KQARAAVGNDGDYYNQRLYSSLPIEVPLNHKRFVCDLTQADRLALYDFVVEETKKKRSDS
QIIENDSDLFVDLAAKVNQDNSRKSPKSYLEILAEVRDYKRRRQSYRAKNVHITKKSYTE
VIRDVINVHMEELSSHWQEEQEKEADGADKSEERRSASVDSRHSGGSHLDGECSRHRRDR
SRSPHRRKRNKDKDRGWDSRRRKERDGERHHSHKRRKQKM
Download sequence
Identical sequences E1B7L0
ENSBTAP00000001494 XP_002697643.1.76553 XP_005193024.1.59421 XP_005223950.1.76553 XP_010797652.1.59421 XP_010816917.1.76553 XP_019841665.1.53367 XP_019841666.1.53367 XP_019841667.1.53367 XP_591305.2.59421 ENSBTAP00000001494 9913.ENSBTAP00000001494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]