SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002709724.1.1745 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002709724.1.1745
Domain Number 1 Region: 63-366,533-568
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.87e-51
Family FAD-linked reductases, N-terminal domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002709724.1.1745
Sequence length 608
Comment PREDICTED: all-trans-retinol 13,14-reductase [Oryctolagus cuniculus]; AA=GCF_000003625.3; RF=representative genome; TAX=9986; STAX=9986; NAME=Oryctolagus cuniculus; breed=Thorbecke inbred; AL=Chromosome; RT=Major
Sequence
MWLWLVLLAVLLAGLRKVYLGLFAGSSPNPFSEDVKRPPAPLVTDREARKKVLRQVFSAS
QVPEKLDVVVIGSGIGGLAAAAILAKAGKRVLVLEQHTKAGGCCHTFGKNGLEFDTGIHY
IGRMQEGSTGRFILDQITEGQLDWAAMCSPFDIVVLEGPNGRKEFPMYSGEEAYIRGLKE
KFPQEEAAIDKYMKLVKVVSSGAIHAILLKFLPLPLAQLLSRCRLLIRFSPFLRASTQSL
AEVLQQLGVSPELHAVLSYIFPTYGVTPSHTTFAMHALLVDHYLKGGFYPRGGSSEIAFH
IIPVIERAGGAVLTKATVQSVLLDSAGKVCGVSVKKGPQLVNVYCPIVISSAGLFNTYEK
LLPEGARSLPGVRQQLRMVRPGLGMFSVFICLRGTKEELGLQSTNYYVYFDTDMDKAMER
YISLPREKAANHIPLLFIASPSAKDPTWEDRFPDRSTMIVLVPSAFKWFEEWQEEPKGKR
SRDYETLKSAFVEASMSVVMRLFPHLEGKVDSAIGGSPLTNQFYLAAPRGACYGADHDLG
RLHPHAMASLRAQSPIPNLYLTGQDIFTCGLMGALQGALLCSSAILKRNLYSDLKDLGSR
IQAQKKKN
Download sequence
Identical sequences G1TGH4
9986.ENSOCUP00000016024 ENSOCUP00000016024 XP_002709724.1.1745 ENSOCUP00000016024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]