SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002712491.1.1745 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002712491.1.1745
Domain Number 1 Region: 5-219
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.26e-68
Family D-ribulose-5-phosphate 3-epimerase 0.00000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002712491.1.1745
Sequence length 228
Comment PREDICTED: ribulose-phosphate 3-epimerase isoform X3 [Oryctolagus cuniculus]; AA=GCF_000003625.3; RF=representative genome; TAX=9986; STAX=9986; NAME=Oryctolagus cuniculus; breed=Thorbecke inbred; AL=Chromosome; RT=Major
Sequence
MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQ
LGQDPFFDMHMMVSRPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK
PGTTVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGP
DTVHKCAEAGANMIVSGSAIMKSEDPRSVINLLRNVCSEAAQKRSLDR
Download sequence
Identical sequences G1TCS3
XP_002712491.1.1745 ENSOCUP00000014599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]