SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002718961.1.1745 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002718961.1.1745
Domain Number 1 Region: 8-219,325-383
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.85e-50
Family FAD-linked reductases, N-terminal domain 0.0000563
Further Details:      
 
Domain Number 2 Region: 223-325
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.08e-25
Family D-aminoacid oxidase-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002718961.1.1745
Sequence length 390
Comment PREDICTED: peroxisomal sarcosine oxidase isoform X1 [Oryctolagus cuniculus]; AA=GCF_000003625.3; RF=representative genome; TAX=9986; STAX=9986; NAME=Oryctolagus cuniculus; breed=Thorbecke inbred; AL=Chromosome; RT=Major
Sequence
MASQTVLYDAIVIGAGIQGCFTAYHLAKHRKSVLLLEQFFLPHSRGSSHGQSRIIRKAYL
EDFYTHMMDECYQLWAQLEQEAGTQLHRRTGLLLLGMAEDPELKSMQATLSRHGLEHQRL
SSEELKQRFPNIRLTKGEVGLLDKSGGVLYADKALRALQDAVRQLGGTVRDGEKVLDIKP
GLPVTVTATSRSYQAKSLIITAGPWTNRLLRPLGIELPLQPLRINVCYWRETVPGSYGAS
QAFPCFLSMGLTPHHVYGLPSGEYPGLMKVCYHHGDTVDPEERDCPRAMTDIQDVQILCD
FVRAHLPNLKPQPDIMERCMYTNTPDTHFILDRHPKYDNIVIGAGFSGHGFKLSPVVGKV
LYELSMKLTPSYDLTPFRISRFPGLGKAHL
Download sequence
Identical sequences G1T932
9986.ENSOCUP00000013124 XP_002718961.1.1745 ENSOCUP00000013124 ENSOCUP00000013124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]