SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002722814.1.1745 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002722814.1.1745
Domain Number 1 Region: 34-125
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 8.24e-38
Family SCAN domain 0.0000409
Further Details:      
 
Domain Number 2 Region: 470-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.3e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 583-640
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.8e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 629-681
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.27e-18
Family Classic zinc finger, C2H2 0.0023
Further Details:      
 
Domain Number 5 Region: 433-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.67e-18
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 6 Region: 516-558
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000212
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 375-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000488
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 8 Region: 212-264
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000183
Family KRAB domain (Kruppel-associated box) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002722814.1.1745
Sequence length 683
Comment PREDICTED: zinc finger protein 263 isoform X1 [Oryctolagus cuniculus]; AA=GCF_000003625.3; RF=representative genome; TAX=9986; STAX=9986; NAME=Oryctolagus cuniculus; breed=Thorbecke inbred; AL=Chromosome; RT=Major
Sequence
MASGPSSQEREGLLIVKLEEDCAWSQELPPPDPGPSPEASHLRFRRFRFQEAAGPREALS
RLQELCHGWLRPELRTKEQILELLVLEQFLTILPQEIQSRVQELHPESGEEAVTLVEDMQ
RELGRLRQQVTTRGRGTEVLLEEPLPLETARESPSFKLEPMETERGPGPRLQELLGPSPQ
RDPQAVKERAVSAPWLSLFPHEGTAEDKALTGPQLPESLENVAVYISQEEWGRQCPRSRA
LASDMAPESSEAVGSLDPHIPRQEALDARVEEGGKVRDSSLRSCKEGLSPSSPAPGEEKF
EDPEESAQFSSPVNSHSEAPPSGQARGEVPWSPEPGRPRDRAEWHWEPPSEDRTEQTLTG
ATSYRELGRPKEVPKKLHLCPLCGKNFSNNSNLIRHQRIHAAERLCVGVECSDLFGGNPH
FLSLHRAHLGEEAHKCLECGKCFSQNTHLTRHQRTHTGEKPYQCNICGKSFSCNSNLHRH
QRTHTGEKPYKCPECGEIFAHSSNLLRHQRIHTGERPYKCPECGKSFSRSSHLVIHERTH
EKERLYPFSECGEAVSDSAPFLPNHGTHKAEKKLFECLTCGKSFRQGMHLTRHQRTHTGE
KPYKCTLCGENFSHRSNLIRHQRIHTGEKPYTCHECGDSFSHSSNRIRHLRTHTGERPYK
CSECGESFSRSSRLMSHQRTHTG
Download sequence
Identical sequences G1T2U4
XP_002722814.1.1745 ENSOCUP00000010508 9986.ENSOCUP00000010508 ENSOCUP00000010508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]