SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002737666.1.86028 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002737666.1.86028
Domain Number 1 Region: 157-189
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000262
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number 2 Region: 97-136
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000017
Family LDL receptor-like module 0.0018
Further Details:      
 
Weak hits

Sequence:  XP_002737666.1.86028
Domain Number - Region: 194-235
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0055
Family LDL receptor-like module 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002737666.1.86028
Sequence length 626
Comment PREDICTED: degenerin-like protein unc-105-like [Saccoglossus kowalevskii]; AA=GCF_000003605.2; RF=representative genome; TAX=10224; STAX=10224; NAME=Saccoglossus kowalevskii; AL=Scaffold; RT=Major
Sequence
MAIGERKFHHFHHFYRALWTVFLVIIALISLIEIVFIVTTYLSYPSRTEVVMVTREQAPF
PSVTVCNVNRLRRSAVANSQYEQLLSLDSLGSISHLMPYMGPCLSGDFECGGECVKWYMQ
CNGVEECRNGEDEINCASDTVIPYGGSRLNCDGGDAVFACDNSECVSSVQQCDYFDNCGD
GSDERNCTYYDQDCGSDGVTCFESDTSYCVPADLVCDRIKHCRTNGEDENNCDYPDIGSN
DLFSANWEDSYLHLTDSDDFYEDFRENIYREPVYGDDGKLSLINTLLLSRSSRVNDVIEQ
TVKFNTEELKTLGHQFEDMLIKCQYNGGKCGHSDFTVFQDNKLGNCFTFNSPSPVNVAGT
QNGLKLTLSLEQDEYLGLFTSGEVGVKVLIHDPDVKPSPETDWFYARSGVSTSKEIKRVE
IKRLSEPFGRCSAEYSSVNECREKCLRYEMLEYCGCTDSLIANETAPCDVTDIRQDLCLQ
LLRHIHRTGVVTCDCPLPCSETKYKVEMTSEATWPSSPYVPHLLEELRYSNVTSQVLNDE
TAIRRNLLLLETYYGSMDSENVASFPEYTMQKLMKDIGVSIAIYLSLFMIIALLVYVCCG
PKCDTQKKKDVEITSKKNSIDATTNF
Download sequence
Identical sequences XP_002737666.1.86028 Sakowv30037800m Sakowv30037801m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]