SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002743149.1.60252 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002743149.1.60252
Domain Number 1 Region: 19-109
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 2.93e-28
Family ECR1 N-terminal domain-like 0.00000401
Further Details:      
 
Domain Number 2 Region: 198-275
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.77e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000732
Further Details:      
 
Domain Number 3 Region: 110-194
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.69e-20
Family Cold shock DNA-binding domain-like 0.00000662
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002743149.1.60252
Sequence length 277
Comment PREDICTED: exosome complex component RRP40 isoform X1 [Callithrix jacchus]; AA=GCF_000004665.1; RF=representative genome; TAX=9483; STAX=9483; NAME=Callithrix jacchus; AL=Chromosome; RT=Major
Sequence
MAEGVSVVAESLAGGGARVARSVLGQVVLPGEELLLPEQEDAEGPGGAGERPLSLNAGAC
SRVRVICGPGLRRCGDRLLVTKCGRLRHKEPGGGGGGGGGVYWVDSQQKRYVPVKGDHVI
GIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEM
VCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIIQEVGKLYPLEIVFGMNGRIW
VKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES
Download sequence
Identical sequences F6QXI9
XP_002743149.1.60252 ENSCJAP00000019534 ENSCJAP00000019553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]