SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002743446.1.60252 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002743446.1.60252
Domain Number 1 Region: 168-291
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.29e-41
Family Eukaryotic type KH-domain (KH-domain type I) 0.000000273
Further Details:      
 
Domain Number 2 Region: 74-166
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.43e-26
Family Cold shock DNA-binding domain-like 0.00000497
Further Details:      
 
Domain Number 3 Region: 25-74
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.00000000000549
Family ECR1 N-terminal domain-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002743446.1.60252
Sequence length 293
Comment PREDICTED: exosome complex component RRP4 isoform X1 [Callithrix jacchus]; AA=GCF_000004665.1; RF=representative genome; TAX=9483; STAX=9483; NAME=Callithrix jacchus; AL=Chromosome; RT=Major
Sequence
MAMEMRLPVARKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSV
ERVNKLICVKALKTRYIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGEL
RRRSAEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVK
RQKTHFHDLPCGASVILGNNGFIWIYPTPEHKEEEAGGFAANLEPVSLADREVISRLRNC
IVSLVTQRMMLYDTSILYCYEASLPHQIKDILKPEIMEEIVMETRQRLLEQEG
Download sequence
Identical sequences F7I4T4
XP_002743446.1.60252 ENSCJAP00000038152 ENSCJAP00000038152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]