SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002746740.1.60252 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002746740.1.60252
Domain Number 1 Region: 60-180
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.22e-29
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000337
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002746740.1.60252
Sequence length 349
Comment PREDICTED: KH domain-containing, RNA-binding, signal transduction-associated protein 2 isoform X1 [Callithrix jacchus]; AA=GCF_000004665.1; RF=representative genome; TAX=9483; STAX=9483; NAME=Callithrix jacchus; AL=Chromosome; RT=Major
Sequence
MEEEKYLPELMAEKDSLDPSFVHASRLLAEEIEKFQGSDGKKEDEEKKYLDVISNKNIKL
SERVLIPVKQYPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKGSMRDKAKEEELRKSG
EAKYAHLSDELHVLIEVFAPPGEAYSRMSHALEEIKKFLVPDYNDEIRQEQLRELSYLNG
SEESGRGRGIRGRGIRIAPTAPSRGRGGAIPPPPPPGRGVLTPRGSTVTRGALPVPPVAR
GVPTPRARGAPAVPGYRAPPPPAHEAYEEYAYDDGYGGEYDDQTYEAYDNSYATQTQSVP
EYYDYGHGVSEDAYDSYATEEWATTRSSLKAPPPRSARGGYREHPYGRY
Download sequence
Identical sequences F7CWI3
ENSCJAP00000003174 XP_002746740.1.60252 ENSCJAP00000003174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]