SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002748420.1.60252 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002748420.1.60252
Domain Number 1 Region: 88-214
Classification Level Classification E-value
Superfamily Lysozyme-like 1.3e-47
Family C-type lysozyme 0.0000263
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002748420.1.60252
Sequence length 215
Comment PREDICTED: sperm acrosome membrane-associated protein 3 isoform X1 [Callithrix jacchus]; AA=GCF_000004665.1; RF=representative genome; TAX=9483; STAX=9483; NAME=Callithrix jacchus; AL=Chromosome; RT=Major
Sequence
MVSALWGAPWIRVCSSPVSSPSASGPLRLVSRLSSQSSALSQSGGGATSFASTEARSRAL
RWRWCPAGTMLLALVSLLSCLFPSSDAKVYGRCELARVLQDFGLDGYRGYSLADWVCLAY
FASGFNTAAVDHEADGSTNNGIFQISSRRWCRNLTPHVPNMCQMYCSDLLNPNLKDTVIC
AMKITQEPQGLGYWEAWRHHCQGKDLTDWVDGCDF
Download sequence
Identical sequences F7I955
XP_002748420.1.60252 ENSCJAP00000026803 ENSCJAP00000051631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]