SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002751887.1.60252 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002751887.1.60252
Domain Number 1 Region: 403-576,605-666
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.12e-44
Family Voltage-gated potassium channels 0.0019
Further Details:      
 
Domain Number 2 Region: 670-855
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.43e-44
Family cAMP-binding domain 0.00047
Further Details:      
 
Domain Number 3 Region: 38-127
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.71e-21
Family Flavin-binding PAS domain 0.00000483
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002751887.1.60252
Sequence length 1160
Comment PREDICTED: potassium voltage-gated channel subfamily H member 2 [Callithrix jacchus]; AA=GCF_000004665.1; RF=representative genome; TAX=9483; STAX=9483; NAME=Callithrix jacchus; AL=Chromosome; RT=Major
Sequence
MPVRRGHVAPQNTFLDTIIRKFEGQSRKFIIANARVENCAVIYCNDGFCELCGYSRAEVM
QRPCTCDFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDG
AVIMFILNFEVVMEKDMVGSPAHDTNHRGPPTSWLAPGRAKTFRLKLPALLALTARESSV
RSGRAGGTGAPGAVVVDVDLAPAAPSSESLALDEMTAMDNHVAGLGPAEERRVLVGRGSP
PAPAPGPLPSPPRAHSLNPDASGSSCSLARTRSRESCASVRRASSADDIEAMRAGALPPP
PRHASTGAMHPLRSGLLNSTSDSDLVRYRTISKIPQITLNFVDLKGDPFLASPTSDREII
APKIKERTHNVTEKVTQVLSLGADVLPEYKLQAPRIHRWTILHYSPFKAVWDWLILLLVI
YTAVFTPYSAAFLLKETEEGPAAPDCGYACQPLAVVDLIVDIMFIVDILINFRTTYVNAN
EEVVSHPGRIAVHYFKGWFLIDMVAAIPFDLLIFGSGSEELIGLLKTARLLRLVRVARKL
DRYSEYGAAVLFLLMCTFALIAHWLACIWYAIGNMEQPHVDSRIGWLHNLGDQIGKPYNS
SGLGGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSLMYASIFGNV
SAIIQRLYSGTARYHTQMLRVREFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNAVLKG
FPECLQADICLHLNRSLLQHCKPFRGATKGCLRALAMKFKTTHAPPGDTLVHAGDLLTAL
YFISRGSIEILRGDVVVAILGKNDIFGEPLNLYARPGKSNGDVRALTYCDLHKIHRDDLL
EVLDMYPEFSDHFWSSLEITFNLRDTNMIPGSPGSAELEGGFSRQRKRKLSFRRRTDKDT
EQPGEVSALGPGRAGAGPSSRGRPGGPWGDSPSSGPSSPESSEDEGPGRSSSPLRLVPFS
SPRPPGELPGGEPLTEDCEKSSDTCNPLSGAFSGVSNIFSFWGDSRGRQYQELPRCPAPT
PSLLNIPLSSPGRRPRSDVESRLDALQRQLNRLETRLSADMASVLQLLQRQMTLVPPAYS
AVTTPGPGPTSTFPMLPVSPLPPLTLDSLSQVSQFMACEELPPGDPELPQDGPTRRLSLP
GQLGALTSQPLHRHGSDPGS
Download sequence
Identical sequences F7BGZ0
ENSCJAP00000037477 ENSCJAP00000037521 ENSCJAP00000014024 XP_002751887.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]