SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002752880.1.60252 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002752880.1.60252
Domain Number 1 Region: 432-645
Classification Level Classification E-value
Superfamily TPR-like 3.79e-32
Family Tetratricopeptide repeat (TPR) 0.0021
Further Details:      
 
Domain Number 2 Region: 660-801
Classification Level Classification E-value
Superfamily TPR-like 7.11e-22
Family Tetratricopeptide repeat (TPR) 0.0077
Further Details:      
 
Weak hits

Sequence:  XP_002752880.1.60252
Domain Number - Region: 179-248
Classification Level Classification E-value
Superfamily SIS domain 0.0304
Family mono-SIS domain 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002752880.1.60252
Sequence length 916
Comment PREDICTED: transmembrane and TPR repeat-containing protein 3 [Callithrix jacchus]; AA=GCF_000004665.1; RF=representative genome; TAX=9483; STAX=9483; NAME=Callithrix jacchus; AL=Chromosome; RT=Major
Sequence
MADINLKEITLIVGVVTACYWNSLFCGFVFDDVSAILDNKDLHPSTPLKTLFQNDFWGTP
MSEERSHKSYRPLTVLTFRLNYLLSELKPMSYHLLNMIFHAVVSVIFLKVCKLFLDNKSS
VIASLLFAVHPVHTEAVTGVVGRAELLSSIFFLAAFLSYTKSKGPDNSIVWTPVALTVFL
VAVATLCKEQGITVVGICCVYEVFIAQGYTLPLLCTTAGQFLRGKGSIPFSMLQTLVKLI
VLMFSTLLLVVIRVQVIQSQLPVFTRFDNPAAVSPTPTRQLTFNYLLPVNAWLLLNPSEL
CCDWTMGTIPLIESLLDIRNLATFTFFCVLGALGVFSLRYSGDSSKTVLMALCLMALPFI
PASNLFFPVGFVVAERVLYVPSMGFCILVAHGWQKISTKSVFKKLSWICLSMVILTHSLK
TFHRNWDWESEYTLFMSALKVNKNNAKLWNNVGHALENEKNFERALKYFVQATHVQPDDI
GAHMNVGRTYKNLNRTKEAEESYMMAKSLMPQIIPGKKYAARIAPNHLNVYINLANLIRA
NESRLEEADQLYRQAISMRPDFKQAYISRGELLLKMNKPLKAKEAYLKALELDRNNADLW
YNLAIVYIELKEPNEALKNFNHALELNPKHKLALFNSAILMQESGEVKLRPEARKRLLSY
INEEPLDANGYFNLGMLAMDDKKDTEAEIWMKKAIKLQADFRSALFNLALLYSQTAKELK
ALPILEELLRYYPDHIKGLILKGDILMNQKKDILGAKKCFEKILEMDPSNVQGKHNLCVV
YFEEKDLLKAERCLVETLALAPHEEYIQRHLNIVRDKISSSGFVEQPIFPISKTSGVEGG
DRIPAESVNEIRGESRQTQIIKTSDNKSLSKSNKQLGKNRDKEPPHKTAKDIKEIEKKRV
AALKRLEEIERILNGE
Download sequence
Identical sequences F7F981
ENSCJAP00000036574 ENSCJAP00000036574 XP_002752880.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]