SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002755062.1.60252 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002755062.1.60252
Domain Number 1 Region: 94-160
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 8.64e-17
Family HLH, helix-loop-helix DNA-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002755062.1.60252
Sequence length 181
Comment PREDICTED: achaete-scute homolog 3 [Callithrix jacchus]; AA=GCF_000004665.1; RF=representative genome; TAX=9483; STAX=9483; NAME=Callithrix jacchus; AL=Chromosome; RT=Major
Sequence
MMDNRSNSSLPDKLPIFSNSACLPMSRSFYLEPTVTFHLHPEAPVPSPYSEELPLLPFPS
DSLIMGNYGEPCPFSFPMPYPNYRRCEYSYGPAFIRKRNERERQRVKCVNEGYAQLRHHL
PEEYLEKRLSKVETLRAAIKYINYLQSLLYPDKAETKNNPGKCSSMIATTSRHADSMFRI
V
Download sequence
Identical sequences F6R0L6
ENSCJAP00000021473 XP_002755062.1.60252 ENSCJAP00000021473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]