SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002758129.1.60252 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002758129.1.60252
Domain Number 1 Region: 164-215,249-428
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 8.03e-61
Family Actin/HSP70 0.0000132
Further Details:      
 
Domain Number 2 Region: 9-170
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.98e-43
Family Actin/HSP70 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002758129.1.60252
Sequence length 429
Comment PREDICTED: actin-like protein 6A isoform X1 [Callithrix jacchus]; AA=GCF_000004665.1; RF=representative genome; TAX=9483; STAX=9483; NAME=Callithrix jacchus; AL=Chromosome; RT=Major
Sequence
MSGGVYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERDDGSTLMEIDGDK
GKQGGPTYYIDTNALRVPRENMEAISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPV
LMSEAPWNTRAKREKLTELMFEHYNIPAFFLCKTAVLTAFANGRSTGLILDSGATHTTAI
PVHDGYVLQQGIVKSPLAGDFITMQCRELFQEMNIELVPPYMIASKEAVREGSPANWKRK
EKLPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGAE
RLKIPEGLFDPSNVKGLSGNTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGNTLIQSF
TDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQEYEEGG
KQCVERKCP
Download sequence
Identical sequences A0A096N6F7 A0A0D9RKQ2 A0A2J8WGU2 A0A2K5IZI3 A0A2K5KXA4 A0A2K5R5F9 A0A2K5UP54 A0A2K6LPG9 A0A2K6Q1R4 G3RI40 H2R190 H9ENZ8 O96019 U3C2I1
9544.ENSMMUP00000012750 9606.ENSP00000397552 ENSP00000397552 ENSP00000376430 NP_001098029.1.72884 NP_004292.1.87134 NP_004292.1.92137 XP_002758129.1.60252 XP_003832013.1.60992 XP_004038093.1.27298 XP_007970221.1.81039 XP_009444902.1.37143 XP_010372176.1.97406 XP_011814057.1.43180 XP_011835772.1.47321 XP_011941639.1.92194 XP_017361795.1.71028 XP_017732627.1.44346 gi|4757718|ref|NP_004292.1| ENSGGOP00000015328 ENSPTRP00000041981 ENSPANP00000008057 ENSGGOP00000015328 ENSPTRP00000041981 ENSMMUP00000012750 ENSMMUP00000012750 HR2893 ENSP00000397552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]