SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002759197.1.60252 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002759197.1.60252
Domain Number 1 Region: 8-179
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.81e-41
Family Ribonuclease PH domain 1-like 0.000000148
Further Details:      
 
Domain Number 2 Region: 152-238
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.96e-23
Family Ribonuclease PH domain 2-like 0.00000479
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002759197.1.60252
Sequence length 245
Comment PREDICTED: exosome complex component RRP41 [Callithrix jacchus]; AA=GCF_000004665.1; RF=representative genome; TAX=9483; STAX=9483; NAME=Callithrix jacchus; AL=Chromosome; RT=Major
Sequence
MAGLELLSDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHEIRG
SRARALPDRALVNCQYSSATFSTGERKRRPHGDRKSCEMGLQLRQTFEAAILTQLHPRSQ
IDIYVQVLQADGGTYAACVNAATLAVLDAGIPMRDFVCACSAGFVDGTALADLSHVEEAA
GGPQLALALLPASGQIALLEMDARLHEDHLEQVLEAAAQAAQDVHILLDRVVRQHVREAS
ILLGD
Download sequence
Identical sequences F7HJR4
ENSCJAP00000039934 XP_002759197.1.60252 ENSCJAP00000039934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]