SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002759936.1.60252 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002759936.1.60252
Domain Number 1 Region: 362-464
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.09e-26
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0016
Further Details:      
 
Domain Number 2 Region: 173-227,254-269,297-315
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.95e-16
Family BphP N-terminal domain-like 0.051
Further Details:      
 
Domain Number 3 Region: 91-174
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000275
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 
Domain Number 4 Region: 570-734
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 0.000000000859
Family Tetraviridae-like VP 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002759936.1.60252
Sequence length 789
Comment PREDICTED: aryl hydrocarbon receptor nuclear translocator isoform X3 [Callithrix jacchus]; AA=GCF_000004665.1; RF=representative genome; TAX=9483; STAX=9483; NAME=Callithrix jacchus; AL=Chromosome; RT=Major
Sequence
MAATTANPEMTSDVPSLGPAIASGNPGPGLQGGGAIVQRAIKRRPGLDFDDDGEGNGKFL
RCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCS
ALARKPDKLTILRMAVSHMKSLRGTGNTSTDGSYKPSFLTDQELKHLILEAADGFLFIVS
CETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDLK
TGTVKKEGQQSSMRMCMGSRRSFICRMRCGSSTVDPVSVNRLSFVRNRCRNGLGSVKDGE
PHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPNCTDMSNVCQP
TEFISRHNIEGIFTFVDHRCVATVGYQPQDLLGKNIVEFCHPEDQQLLRDSFQQVVKLKG
QVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQEPRPALSNAVQ
RPQLGPTANLPLEMGSGQLAPRQQQQQTELDMVPGRDGLASYNHSQVVQPVTTTGPEHSK
PLEKSDGLFAQDRDPRFSEIYHNINADQSKGISSSTVPATQQLFSQGNTFPPTPRPAENF
RNSGLAPPVTIVQPSASAGQMLAQISRHSNPTQGAAPTWTPTTRSGFSAQQVATQATTKA
RTSQFGMGSFQTPSSFSSMSLPGAPTASPGAAAYPSLTNRGSNFAPETGQTAGQFQTRTA
EGVGVWPQWQGQQPHHRSSSSEQHVQQSSAQQPGQPEVFQEMLSMLGDQSNSYNNEEFPD
LTMFPPFSE
Download sequence
Identical sequences F6SBL2
ENSCJAP00000012901 ENSCJAP00000012876 XP_002759936.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]