SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002770654.1.41535 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002770654.1.41535
Domain Number 1 Region: 141-256
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000693
Family UAS domain 0.054
Further Details:      
 
Domain Number 2 Region: 356-436
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000171
Family UBX domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002770654.1.41535
Sequence length 466
Comment DEHA2G16852p [Debaryomyces hansenii CBS767]; AA=GCF_000006445.2; RF=representative genome; TAX=284592; STAX=4959; NAME=Debaryomyces hansenii CBS767; strain=CBS767; AL=Chromosome; RT=Major
Sequence
MSRLSTSWIRHLLGQGSYQPLANSVDSSEANSDILPGNYPEERVLHNNRNAINSNSIQHV
FKHLSSWISFLIIKPIIIILVLSFRILAKLINIIYFRDQYTRTNSGKAANLAINKTGLND
PIDKVNKFIRDLEDNLSPLQQRHLESGLNPQLPPFFVGSYTQALYMATNRAKFLFVYLSN
SQNENSSTIFNKVITNPDFISLFNSNPNILIWGGDLTNPEAYQLANSLNVTKFPFLGLLC
LTRTTTMSQQGPVKTSPKISLISKIQGGLNEDINISATVIDKFKRKIRKFDEELIVMRTE
LRDKYMSQVLLRQQDINYQNSLKNDQLKKQEKLYKELKREYLNWKSLYFNKLKQENDLED
SAKIAIKLTNGERITFHFPSQNLIDDIFIFVELQNDDYLDGNIKSSITDEEAFERFKDFE
LKYEFKLVSPLPPRTELNNYLDEENHPKIRDINYIYPNGLLIVEDL
Download sequence
Identical sequences B5RUU3
4959.B5RUU3 XP_002770654.1.41535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]