SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002801782.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002801782.1.72884
Domain Number 1 Region: 17-110
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000511
Family Thioltransferase 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002801782.1.72884
Sequence length 198
Comment PREDICTED: prostamide/prostaglandin F synthase isoform X1 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MSTVDLARVGACILKHAVTGEAVELRSLWRDRACVVAGLRRFGCVVCRWIAQDLSGLAGL
LEQHGVRLVGVGPEALGLQEFLDGGYFAGELYLDESKQLYKELGFKRYNSLSILPAALGK
PVRDVAAKAKAVGIQGNLSGDLLQSGGLLVVSKGGDKVLLHFVQKSPGDYVPQEHILQVL
GISAEVCASNPPQCDREV
Download sequence
Identical sequences ENSMMUP00000016259 XP_002801782.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]