SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002801827.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002801827.1.72884
Domain Number 1 Region: 250-486
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-64
Family Nuclear receptor ligand-binding domain 0.000000549
Further Details:      
 
Domain Number 2 Region: 7-91
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.73e-30
Family Nuclear receptor 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002801827.1.72884
Sequence length 497
Comment PREDICTED: nuclear receptor ROR-gamma isoform X2 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MRTQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQRCNAAYSCTRQQNCPIDRTSRN
RCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQRQQQQQEPVVKTPPAGA
QGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLRASGSGPSYSNNLAKAGLNGASCH
LEYSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPGLGELGQGPDSYGSPSFRSTPE
APYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCA
HHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNHTVFFEGK
YGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINANRPGLQEKRKVEQ
LQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPL
YKELFSTETESPVGLSK
Download sequence
Identical sequences A0A2K5M6L2 A0A2K5UAQ9 A0A2K6A2F6
XP_002801827.1.72884 XP_005541907.1.63531 XP_011828898.1.47321 XP_011925035.1.92194 ENSMMUP00000015923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]