SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002802213.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002802213.1.72884
Domain Number 1 Region: 465-750
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.47e-81
Family Protein kinases, catalytic subunit 0.000000000174
Further Details:      
 
Domain Number 2 Region: 162-247
Classification Level Classification E-value
Superfamily Immunoglobulin 2.94e-20
Family I set domains 0.0000137
Further Details:      
 
Domain Number 3 Region: 253-355
Classification Level Classification E-value
Superfamily Immunoglobulin 7.86e-19
Family I set domains 0.0000662
Further Details:      
 
Domain Number 4 Region: 48-129
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000614
Family I set domains 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002802213.1.72884
Sequence length 808
Comment PREDICTED: fibroblast growth factor receptor 3 isoform X7 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MGAPACALALCVAVAIVAGASSESLGTEQRVVGRVAEVSGPEPSQQEQLVFGSGDAVELS
CPPPGGGPMGPTVWVKDGAGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQLVLCH
FSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAG
NPTPSISWLKNGKEFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQT
YTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGP
DGTPYVTVLKSWISESVEADVRLRLANVSERDGGEYLCRATNFIGVAEKAFWLSVHRPRA
AEEELVEADEAGSVYAGILSYGVGFFLFILVVAAVTLCRLRSTPKKGLGSPTVHKISRFP
LKRQVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPL
GEGCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNI
INLLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCA
YQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPV
KWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPAN
CTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTP
SSSSSGDDSVFAHDLLPPAPPSSGGSRT
Download sequence
Identical sequences A0A2K5V1U0
ENSMMUP00000026226 9544.ENSMMUP00000026225 ENSMMUP00000026225 XP_002802213.1.72884 XP_005554345.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]