SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002807249.2.60252 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002807249.2.60252
Domain Number 1 Region: 41-115
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000373
Family Rhamnogalacturonase B, RhgB, middle domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002807249.2.60252
Sequence length 241
Comment PREDICTED: ER membrane protein complex subunit 7 [Callithrix jacchus]; AA=GCF_000004665.1; RF=representative genome; TAX=9483; STAX=9483; NAME=Callithrix jacchus; AL=Chromosome; RT=Major
Sequence
MAAALWGFFPVLLLLLSGDVQSSEMPGAAAEGSVGSGVGIGDRFKIEGRAVVPGVKPQDW
ISAARVLVDGEEHVGFLKTDGSFVVHDIPSGSYVVEVVSPAYRFDPVRVDITSKGKMRAR
YVNYIKTSEVVRLPYPLQMKSSGPPSYFIKRESWGWTDFLMNPMVMMMVLPLLIFVLLPK
VVNTSDPDMRREMEQSMNMLNSNHELPDVSEFMTRLFSSKSSGKSSSGSSKSGKSGAGKR
R
Download sequence
Identical sequences F7F1K2
ENSCJAP00000039275 XP_002807249.2.60252 ENSCJAP00000039275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]