SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002812621.1.23681 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002812621.1.23681
Domain Number 1 Region: 310-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.05e-16
Family Classic zinc finger, C2H2 0.0021
Further Details:      
 
Domain Number 2 Region: 343-382
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000507
Family Classic zinc finger, C2H2 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002812621.1.23681
Sequence length 398
Comment PREDICTED: transcription factor Sp5 [Pongo abelii]; AA=GCF_000001545.4; RF=representative genome; TAX=9601; STAX=9601; NAME=Pongo abelii; AL=Chromosome; RT=Major
Sequence
MAAVAVLRNDSLQAFLQDRTPSASPDLGKHSPLALLAATCSRIGQPGATAPPDFLQVPYD
PALGSPSRLFHPWTADMPAHSPGALPPPHPSLGLTPQKTHLQPSFGAAHELPLTPPADPS
YPYEFSPVKMLPSSMAALPASCAPAYVPYAAQAALPPGYSNLLPPPPPPPPPPTCRQLSP
NPAPDDLPWWSIPQAGAGPGASGVPGSGLSGACAGGPHAPRFPASAAAAAAAAAALQRGL
VLGPSDFAQYQSQIAALLQTKAPLAATARRCRRCRCPNCQAAGGAPEAEPGKKKQHVCHV
PGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKSFTRSDELQRHLRTHTGEKRFACPE
CGKRFMRSDHLAKHVKTHQNKKLKVAEAGVKREDARDL
Download sequence
Identical sequences H2P7S8
ENSPPYP00000014424 9600.ENSPPYP00000014424 XP_002812621.1.23681 ENSPPYP00000014424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]