SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002814320.1.23681 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_002814320.1.23681
Domain Number - Region: 12-170
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0675
Family Voltage-gated potassium channels 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002814320.1.23681
Sequence length 207
Comment PREDICTED: claudin-11 [Pongo abelii]; AA=GCF_000001545.4; RF=representative genome; TAX=9601; STAX=9601; NAME=Pongo abelii; AL=Chromosome; RT=Major
Sequence
MVATCLQVVGFVTSFVGWIGVIVTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVMAT
GLYHCKPLVDILILPGYVQACRALMIAASVLGLPAILLLLTVLPCIRMGQEPGVAKYRRA
QLAGVLLILLALCAIVATIWFPVCAHRETTIVSFGYSLYAGWIGAVLCLVGGCVILCCAG
DAQAFGENRFYYTAGSSSPTHAKSAHV
Download sequence
Identical sequences A0A2I2ZIY0 H2PBZ5
9600.ENSPPYP00000015975 XP_002814320.1.23681 XP_004038046.1.27298 ENSGGOP00000027164 ENSPPYP00000015975 ENSPPYP00000015975 ENSGGOP00000027164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]