SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002818518.1.23681 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002818518.1.23681
Domain Number 1 Region: 52-112
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000576
Family HLH, helix-loop-helix DNA-binding domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002818518.1.23681
Sequence length 330
Comment PREDICTED: stimulated by retinoic acid gene 8 protein homolog [Pongo abelii]; AA=GCF_000001545.4; RF=representative genome; TAX=9601; STAX=9601; NAME=Pongo abelii; AL=Chromosome; RT=Major
Sequence
MGKIDMDKILIFNQEIRLWQLIMATPEENSNPHDRTTPQLPAQLQELEHRVARRRLSQAR
HRATLAALFNNLRKTVYSQSDLTASKWQVLNKAKSHIPELEQTLDNLLKLKASFNLEDGH
ASSLEEVKKEYASMYSGNDSFPQNGSSPWYLNFYKQTMDLLTGSGIITPQEAALPIVSAA
ISHLWQNLSEERKASLRQAWAQKHRGPATLAEACREPACAEGSVKDSGVDSQGASCSLVS
TPEEILFEDAFDVASFLDKSEVPSTSSSSSVLASCNPENPEEKFQLYMQIIDFFKGLSCA
NTQVKQEASFPVDEEMIMLQCTETFDDEDL
Download sequence
Identical sequences H2PNL3
ENSPPYP00000020227 XP_002818518.1.23681 9600.ENSPPYP00000020227 ENSPPYP00000020227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]