SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002819174.1.23681 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002819174.1.23681
Domain Number 1 Region: 240-316
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.19e-16
Family HLH, helix-loop-helix DNA-binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002819174.1.23681
Sequence length 380
Comment PREDICTED: class E basic helix-loop-helix protein 22 [Pongo abelii]; AA=GCF_000001545.4; RF=representative genome; TAX=9601; STAX=9601; NAME=Pongo abelii; AL=Chromosome; RT=Major
Sequence
MERGMHLGAAAAGEDDLFLHKSLSASTAKRLEAAFRSTPPGMDLSLAPPPRERPASSSSS
PLGCFEPADPEGAGLLLPPPGGGGGGGGGAGSGGGGGGGVGVPGLLVGSAGVGGDPSLSS
LPAGAALCLKYGESASRGSVAESSGGEQSPDDDSDGRCELVLRAGVADPRASPGAGGGGA
KAAEGCSNAHLHGGASVPPGGLGGGGGGGSSSGSSGGAGGGGGGSGGSSSSSSKKSKEQK
ALRLNINARERRRMHDLNDALDELRAVIPYAHSPSVRKLSKIATLLLAKNYILMQAQALE
EMRRLVAYLNQGQAISAASLPSSAAAAAAAAALHPALGAYEQAAGYPFSAGLPPAASCPE
KCALFNSVSSSLCKQCTEKP
Download sequence
Identical sequences H2PQF3
XP_002819174.1.23681 9600.ENSPPYP00000020893 ENSPPYP00000020893 ENSPPYP00000020893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]