SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002820062.1.23681 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002820062.1.23681
Domain Number 1 Region: 134-207
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 2.75e-27
Family DNA repair factor XPA DNA- and RPA-binding domain, C-terminal subdomain 0.00000772
Further Details:      
 
Domain Number 2 Region: 98-132
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000143
Family DNA repair factor XPA DNA- and RPA-binding domain, N-terminal subdomain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002820062.1.23681
Sequence length 273
Comment PREDICTED: DNA repair protein complementing XP-A cells [Pongo abelii]; AA=GCF_000001545.4; RF=representative genome; TAX=9601; STAX=9601; NAME=Pongo abelii; AL=Chromosome; RT=Major
Sequence
MAATDGALPEAAALEQPAELPATVRASIERKRQRALMLRQARLAARPYSATAAAATGGMA
NVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHEPGPVMEFDYVICEECGKEFMDSYLMNH
FDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKL
YLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETI
VHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM
Download sequence
Identical sequences H2PSU6
9600.ENSPPYP00000021770 XP_002820062.1.23681 ENSPPYP00000021770 ENSPPYP00000021770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]