SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002825703.1.23681 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002825703.1.23681
Domain Number 1 Region: 64-494
Classification Level Classification E-value
Superfamily Sema domain 1.7e-112
Family Sema domain 0.00000178
Further Details:      
 
Domain Number 2 Region: 491-527
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000523
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 3 Region: 543-619
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000762
Family I set domains 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002825703.1.23681
Sequence length 664
Comment PREDICTED: semaphorin-7A [Pongo abelii]; AA=GCF_000001545.4; RF=representative genome; TAX=9601; STAX=9601; NAME=Pongo abelii; AL=Chromosome; RT=Major
Sequence
MTPPPPGRAAPSAPRSRVPGPPARLGLPLRLLLLLWAAAASAQGHLRSGPRIFAVWKGHV
GQDRVDFGQTEPHTVLFHEPGSSSVWVGGRGKVYLFDFPEGKNASVRTVNIGSTKGSCLD
KRDCENYITLLERRSEGLLACGTNARHPSCWNLVNGTVVPLGEMRGYAPFSPDENSLVLF
EGDEVYSTIRKQEYNGKIPRFRRIRGESELYTSDTVMQNPQFIKATIVHQDQAYDDKIYY
FFREDNPDKNPEAPLNVSRVAQLCRGDQGGESSLSVSKWNTFLKAMLVCSDAATNKNFNR
LQDVFLLPDPSGQWRDTRVYGVFSNPWNYSAVCVYSLGDIDKVFRTSSLKGYHSSLPNPR
PGKCLPDQQPIPTETFQVADRHPEVAQRVEPMGPLKTPLFHSKYHYQKVAVHRMQASHGE
TFHVLYLTTDRGTIHKVVEPGEQEHSFVFNIMEIQPFRRAAAIQTMSLDAERRKLYVSSQ
WEVSQVPLDLCEVYGGGCHGCLMSRDPYCGWDHGRCVSIYSSERSVLQSINPAEPHKECP
NPKPDKAPLQKVSLAPNSRYYLSCPMESRHATYSWRHKENVEQSCEPGHQSPNCILFIEN
LTAQQYGHYFCEAQEGSYFREAQHWQLLPEDGIMAEHLLGHACALAASLWLGVLPTLTLV
LLVH
Download sequence
Identical sequences H2NNR6
XP_002825703.1.23681 ENSPPYP00000007529 ENSPPYP00000007529 9600.ENSPPYP00000007529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]