SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002827246.1.23681 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002827246.1.23681
Domain Number 1 Region: 1036-1161
Classification Level Classification E-value
Superfamily GAF domain-like 0.000000834
Family GAF domain 0.023
Further Details:      
 
Domain Number 2 Region: 858-914
Classification Level Classification E-value
Superfamily EF-hand 0.0000922
Family Polcalcin 0.065
Further Details:      
 
Weak hits

Sequence:  XP_002827246.1.23681
Domain Number - Region: 285-406
Classification Level Classification E-value
Superfamily EF-hand 0.000737
Family Calmodulin-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002827246.1.23681
Sequence length 1505
Comment PREDICTED: EF-hand calcium-binding domain-containing protein 5 [Pongo abelii]; AA=GCF_000001545.4; RF=representative genome; TAX=9601; STAX=9601; NAME=Pongo abelii; AL=Chromosome; RT=Major
Sequence
MNESTTQEELRPAQENGKEDKERKWNLTEVKELHETLQSVPDVPVKEATNNVVEKATDEI
KSQELNLEGQQKISPGSIKDSKTEASSNIAIRKSAKVIFALDETELKSKPEHTWKKNLFE
RMEARAQAMQQKIIDKENLKKELEKKAEKKLPRDNLAKEWFNTESMTLNNRAYLLDKLLP
TLVPGVENMLTQVEKKKVLTEADTPRKFDPINYLGEYLMRNNPNYIKDPGMSGYQRVMKE
VTEDLKIYVPDTICNRVSKMKENVKQNRKQRESIDKIKVKVANTRKQALQEQFDEWILDP
KGMIPKSVIQNVLHEFFQNPDFKLGSHCKQLDITDSTEPRLNKMEFTEYISSHIKDLKSE
MFEELLKHLCHSADEFREVIKADMRRQMFAELFLHCDHGKVGFLDRQRTLALLELFYDHS
SPMLRSLLRNPRQWPFIEFEEINLTELWGDMDNQKHIYEGLDKVLLEMNTLLSAKHASKT
QSKLLESPDQPKLDEPRTSTPPPNPPEQRRGVTAEQGPQRISTEEQEQGKKPTAEQEPYI
ESVIEPGTHTESTLEQGSSRGLLTEQETHRESTTEQGQHKGSIEGQGQGPRRVSVSGQGS
SRESVAEQGSCRESIAEQDRRKGSVAEQGSRRMSAAEQGSLRESIIEEPYQKSEQGPYGG
IISEEQEDIGSTSQSRKDSILKSTKYGEPIYSEYTEVPLQEKRSWEQTYEEEIFLSSELQ
EEVPTLSRKDHFSETTKKEVQKDKPCEPKSQEIEGKSWSGEFFTCNWKMKYVTFEDEEQA
NSIYGNSRFTDLHSIIRNIQSCKEIKGRTAFNGVSFNLLQFVQLLETFVGEDAPLSVSET
LTSFFKEGYVETEQEKMNALKQFSQNAFQVRQRLLLEAIFQKWDSDGSGFLDLKEVDELL
YTYKEGMEKESMKKAKLHIQFPKPHPGHEVRLSSKQFQNYIELVMSELRGNEDQVLESVV
EFLMNALQRSHIESLRNCARRKWLHQIQRAAETSGVSLEPVYSETFKALTQDAEAHGNKK
ISAHISLLEENLLLPEKGNVLLRNVACTLDDALFVLNRVLYRDMKGISFTVVDEGKPIHV
PQVQYHGNIFFWNQSRNKNDYNGSFLALPLQDAYMRIFGVLAVDTLRDPHKINIFLPHEI
RFYQGVANVFSTAYHYVHSREHILHIVITGIGWLYDVTSRITSITMYFVEPSPAQDSDYV
LRNMMVTGQLGLTEIHKNPPTIHRKSCIFRDFLFKCTDSSEVVLASACGETHIVVPLRER
TGEALGVLDFNIGQNRMLLDQEYKDLQKMMKVVQVACYEILGEFSGEIEKKYILEIENVG
EVQRAGILFFRIMLLELQESIQLLNSTDFVSLLLYDHTLPTKPNSPQDSKSMELEANVKL
VRDILKAVILFFHPELEFSTDFGSWDKCKFYVNKYLVNNICAFDPTAKHVEVNVQLIDEY
IRDHSRTEVWKFGNVVIEHLYHWIHICSALTKITKQLNSAITPPLPSKTDNYMYAKMPGE
GLQEK
Download sequence
Identical sequences H2NT71
XP_002827246.1.23681 ENSPPYP00000009139 ENSPPYP00000009139 9600.ENSPPYP00000009139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]