SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002827807.1.23681 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002827807.1.23681
Domain Number 1 Region: 41-315
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.53e-69
Family Protein kinases, catalytic subunit 0.0000019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002827807.1.23681
Sequence length 334
Comment PREDICTED: dual specificity mitogen-activated protein kinase kinase 6 isoform X1 [Pongo abelii]; AA=GCF_000001545.4; RF=representative genome; TAX=9601; STAX=9601; NAME=Pongo abelii; AL=Chromosome; RT=Major
Sequence
MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELG
RGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALF
REGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDV
KPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDI
WSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSK
ERPTYPELMQHPFFTLHESKGTDVASFVKLILGD
Download sequence
Identical sequences A0A096NU44 A0A0D9QWI2 A0A2K5P0S9 A0A2K5WZY2 A0A2K5YG13 A0A2K6CS09 A0A2K6LB21 A0A2K6P656 A8K3Y2 G1QQD5 G3QTE4 H2NUJ7 H2QZW5 H9EP89 P52564
ENSPTRP00000039686 ENSPTRP00000039686 ENSNLEP00000003153 ENSGGOP00000005958 ENSP00000468348 gi|14589900|ref|NP_002749.2| ENSNLEP00000003153 HR2906 ENSMMUP00000001409 9544.ENSMMUP00000001409 9598.ENSPTRP00000039686 9600.ENSPPYP00000009634 9606.ENSP00000351997 ENSPPYP00000009634 ENSP00000351997 ENSPPYP00000009634 ENSP00000468348 NP_001248635.1.72884 NP_002749.2.87134 NP_002749.2.92137 XP_002827807.1.23681 XP_003276131.1.23891 XP_003808992.1.60992 XP_008010157.1.81039 XP_010351423.1.97406 XP_011717941.1.29376 XP_011842312.1.47321 XP_011898103.1.92194 XP_015293315.1.63531 XP_017719217.1.44346 XP_523699.2.37143 ENSMMUP00000001409 ENSGGOP00000005958 ENSPANP00000016565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]