SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002829127.1.23681 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_002829127.1.23681
Domain Number - Region: 210-246
Classification Level Classification E-value
Superfamily HMG-box 0.0074
Family HMG-box 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002829127.1.23681
Sequence length 246
Comment PREDICTED: protein lin-37 homolog isoform X1 [Pongo abelii]; AA=GCF_000001545.4; RF=representative genome; TAX=9601; STAX=9601; NAME=Pongo abelii; AL=Chromosome; RT=Major
Sequence
MFPVKVKVEKSELEMAKARNQLDAVLQCLLEKSHMDRECLDEEAGKTPSDTHNKDCSIAA
TGKRPSARFPHQRRKKRREMDDGLAEGGPQRSNTYVIKLFDRSVDLAQFSENTPLYPICR
AWMRNSPSVRERECSPSSPLPPLPEDEEGSEVTNSKSRDVYKLPPPTPPGPPGDACRSRI
PSPLQPEMQGTPDDEPSEPEPSPSTLIYRNMQRWKRIRQRWKEASHRNQLRYSESMKILR
EMYERQ
Download sequence
Identical sequences H2NYI0
9600.ENSPPYP00000011061 XP_002829127.1.23681 ENSPPYP00000011061 ENSPPYP00000023940 ENSPPYP00000011061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]