SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002831229.1.23681 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002831229.1.23681
Domain Number 1 Region: 36-153
Classification Level Classification E-value
Superfamily TPR-like 1.07e-19
Family Tetratricopeptide repeat (TPR) 0.01
Further Details:      
 
Domain Number 2 Region: 832-870
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000149
Family Classic zinc finger, C2H2 0.054
Further Details:      
 
Domain Number 3 Region: 884-918
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000275
Family CCCH zinc finger 0.0048
Further Details:      
 
Domain Number 4 Region: 482-511
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000804
Family CCCH zinc finger 0.005
Further Details:      
 
Weak hits

Sequence:  XP_002831229.1.23681
Domain Number - Region: 755-787
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000157
Family CCCH zinc finger 0.0069
Further Details:      
 
Domain Number - Region: 611-642
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00255
Family CCCH zinc finger 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002831229.1.23681
Sequence length 977
Comment PREDICTED: zinc finger CCCH domain-containing protein 7B [Pongo abelii]; AA=GCF_000001545.4; RF=representative genome; TAX=9601; STAX=9601; NAME=Pongo abelii; AL=Chromosome; RT=Major
Sequence
MERQKRKADIEKGLQFIQSTLPLKQEEYEAFLLKLVQNLFAEGNDLFREKDYKQALVQYM
EGLNVADYAASDQVALPRELLCKLHVNRAACYFTMGLYEKALEDSEKALGLDNESIRALF
RKARALNELGRHKEAYECSSRCSLALPHDESVTQLGQELAQKLGLRVRKAYKRPQELETF
SLLSNGTAAGVADQGTSNGLGSLDDIETDCYVDPRGSPALLPSTPTMPLFPHVLDLLAPL
DSIRTLPSTESLDDFSDGDVFGPELDTLLDSLSLVQGGLSGSGVPSELPQLIPVFPGGTP
LLPPVVGGSIPVSSPLPPASFGLVMDPSKKLAASVLDALDPPGPTLDPLDLLPYSETRLD
ALDSFGSTRGSLDKPDSFMEETNSQDHRPPSGAQKPAPSPEPCMPNTALLIKNPLAATHE
FKQACQLCYPKTGPRAGDYTYREGLEHKCKRDILLGRLRSSEDQIWKRIRPRPTKTSFVG
SYYLCKDMINKQDCKYGDNCTFAYHQEEIDVWTEERKGTLNRDLLFDPLGGVKRGSLTIA
KLLKEHQGIFTFLCEICFDSKPRIISKGTKDSPSVCSNLAAKHSFYNNKCLVHIVRSTSL
KYSKIRQFQEHFQFDVCRHEVRYGCLREDSCHFAHSFIELKVWLLQQYSGMTHEDIVQES
KKYWQQMEAHAGKASSSMGAPRTHGPSTFDLQMKFVCGQCWRNGQVVEPDKDLKYCSAKA
RHCWTKERRVLLVMSKAKRKWVSVRPLPSIRNFPQQYDLCIHAQNGRKCQYVGNCSFAHS
PEERDMWTFMKENKILDMQQTYDMWLKKHNPGKPGEGTPISSREGEKQIQMPTDYADIMM
GYHCWLCGKNSNSKKQWQQHIQSEKHKEKVFTSDSDASGWAFRFPMGEFRLCDRLQKGKA
CPDGDKCRCAHGQEELNEWLDRREVLKQKLAKARKDMLLCPRDDDFGKYNFLLQEDGDPA
SATPEAPAAAATATTGE
Download sequence
Identical sequences H2P4J0
ENSPPYP00000013242 ENSPPYP00000013242 XP_002831229.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]