SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002841042.1.11696 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002841042.1.11696
Domain Number 1 Region: 164-359
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.51e-31
Family Hypothetical protein AT3g04780/F7O18 27 0.001
Further Details:      
 
Domain Number 2 Region: 4-109
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.18e-27
Family Thioltransferase 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002841042.1.11696
Sequence length 378
Comment hypothetical protein [Tuber melanosporum Mel28]; AA=GCF_000151645.1; RF=representative genome; TAX=39416; STAX=39416; NAME=Tuber melanosporum; strain=Mel28; AL=Scaffold; RT=Major
Sequence
MANVSIITSPEQFEELKKTSTLLIIDFHAIWCAPCKIVNPVFMKLAEKFASPGKIVFAKC
DVDDNQQISKDLDVTVMPSFLVFNNGALVERVQGARPMVLRTTLTKLVEGVQASDSGSSS
AAEGLTASETKPTATSSTSAATASTAAGTTSTPAVNTSDDSDAGWLGAELPKPYSDVTDQ
VNLKQLDLLNANSEFGPAKTLFDMKAPSKATASSKGKEKDSGTEVAASRDWVESDTDEQL
MLFIPFQSTVKIHTLQVTSLAPAPEHPDYDKDSDTPSRPKTIKIWVNPPHTLSFEDGESP
ATQEITLNPSDWDPKTGTVSVPLKYVKFQSVSTLNIFFVDVENEDAEKVRIDRLRVIGEK
GEKKEMGKLEKIGDLSGE
Download sequence
Identical sequences D5GL40
GSTUMT00009960001 CAZ85233 XP_002841042.1.11696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]