SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002864798.1.15461 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002864798.1.15461
Domain Number 1 Region: 5-132
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.82e-40
Family Calponin-homology domain, CH-domain 0.0000348
Further Details:      
 
Domain Number 2 Region: 187-247
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 2.09e-19
Family EB1 dimerisation domain-like 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002864798.1.15461
Sequence length 288
Comment ATEB1B [Arabidopsis lyrata subsp. lyrata]; AA=GCF_000004255.2; RF=representative genome; TAX=81972; STAX=59689; NAME=Arabidopsis lyrata subsp. lyrata; AL=Scaffold; RT=Minor
Sequence
MATNIGMMDSAYFVGRNEILSWINDRLHLNLSRIEEAASGAVQCQMLDMTFPGVVPMHKV
NFEAKNEYEMIQNYKVMQEVFTKLKITKPLEVNRLVKGRPLDNLEFLQWLKRFCDSINGG
IMNENYNPVERRSRGGREKSVKGSSKISKSLQTNNMHHPPVTTSNKPAGPKQAKSHAIGG
GSNTSAEVQALSKEVADLKVSVDLLEKERDFYFSKLRDIEILCQTPELDDLPIVVAVKKV
LYATDADESVLEEAQECLNQSLGLEVDEEEGKEEEEEEEEEAAAETQT
Download sequence
Identical sequences D7MMB6
XP_002864798.1.15461 59689.fgenesh2_kg.8__2244__AT5G62500.1 jgi|Araly1|496428|fgenesh2_kg.8__2244__AT5G62500.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]