SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002889439.1.15461 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002889439.1.15461
Domain Number 1 Region: 1-150
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.79e-27
Family N-acetyl transferase, NAT 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002889439.1.15461
Sequence length 174
Comment hypothetical protein ARALYDRAFT_887467 [Arabidopsis lyrata subsp. lyrata]; AA=GCF_000004255.2; RF=representative genome; TAX=81972; STAX=59689; NAME=Arabidopsis lyrata subsp. lyrata; AL=Scaffold; RT=Minor
Sequence
MTTIRRFSCNDLLRFTSVNLDHLTETFNMSFYMTYLARWPDYFHVAEGPGNRVMGYIMGK
VEGQGESWHGHVTAVTVSPEYRRQQLAKKLMNLLEDISDKIDKAYFVDLFVRASNTPAIK
MYEKLGYIIYRRVLRYYSGEEDGLDMRKALSRDVEKKSVIPLKRPITPDELEYD
Download sequence
Identical sequences A0A087HKM3 A0A178WDM9 D7KCB9 Q8LGI8 R0IDH7
NP_563677.1.80155 XP_002889439.1.15461 XP_006303362.1.15642 XP_010474913.1.75697 XP_010474924.1.75697 3702.AT1G03150.1-P 59689.scaffold_100261.1 jgi|Araly1|887467|scaffold_100261.1 AT1G03150.1 GO.132 Carubv10010452m|PACid:20891198 AT1G03150.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]