SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002899659.1.21288 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002899659.1.21288
Domain Number 1 Region: 53-139
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 8.24e-20
Family Ypt/Rab-GAP domain of gyp1p 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002899659.1.21288
Sequence length 408
Comment conserved hypothetical protein [Phytophthora infestans T30-4]; AA=GCF_000142945.1; RF=representative genome; TAX=403677; STAX=4787; NAME=Phytophthora infestans T30-4; strain=T30-4; AL=Scaffold; RT=Major
Sequence
MNYVVAALLLVMKDAQEVTDTDLDGLSTQEAAFWLTLALIRRKGMAELWKHKMPGLSQCI
YLFQQLLKLHFYDLSAHFRHIGMHSSILVTQWFVTIFARVLALPTLVRVWDLVLLDGWKA
VYRVALAITAELRPKLLAMFFRKNPKLGLEEYLRLRLQQTPLSEEHRMLFPTLEHEDVAA
KKKSLELIRSKLQRFDTDVASDTVFLQHKIELAEKAQATAMSVRYAIAYELSEAAIELNE
RLEIKNRLRSKFRKLMATAITEATTSSSSSSSGFSLWMNPFDFLNERMASCFERLPLISS
YLDTDTDDEEDIEAQQNLKHLDMLVPQLAAELRLLQRSLAYNERLVRPLVQRTRRLQRDA
QLARVEVEETQLFKDRLADQLLQIMLTSEKLKNERMQQLFAEVDRNKL
Download sequence
Identical sequences D0NNB2
PITG_14007 XP_002899659.1.21288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]