SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002901771.1.21288 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002901771.1.21288
Domain Number 1 Region: 216-364
Classification Level Classification E-value
Superfamily eEF1-gamma domain 1.57e-49
Family eEF1-gamma domain 0.0000595
Further Details:      
 
Domain Number 2 Region: 1-86
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.83e-18
Family Glutathione S-transferase (GST), N-terminal domain 0.0038
Further Details:      
 
Domain Number 3 Region: 70-152
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.0000000000000766
Family Glutathione S-transferase (GST), C-terminal domain 0.0085
Further Details:      
 
Weak hits

Sequence:  XP_002901771.1.21288
Domain Number - Region: 165-185
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.0918
Family Double-stranded RNA-binding domain (dsRBD) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002901771.1.21288
Sequence length 367
Comment elongation factor 1-gamma, putative [Phytophthora infestans T30-4]; AA=GCF_000142945.1; RF=representative genome; TAX=403677; STAX=4787; NAME=Phytophthora infestans T30-4; strain=T30-4; AL=Scaffold; RT=Major
Sequence
MKLYIYPGNYRAFKVLIAAEYNGVDIELPAFDFAKDIKTKEFKAKTPIGKVPILETEEGA
IFESGAIARYIARLRPDTGLYGKTFFESGLVDAWIDFSAYELEVPLEVWVYPILNVGKFN
AAALAKAKADVKKVLQTLENHLHLRTYLVGEQAVVVGDVPLIDVALTAEGDNSSKKAAKK
DAAKKDAPKKEKAAPKEEAPKPKKVEHPLAVLNREKPSSLNLDAWKVQYSNTRNLADAMT
WFWEHLDTEGYSLWFCDYNYNNENTKMFMTCNAVGGFLQRSEAMRKYAFGVMDVCGAEGS
EIIITGCWLFRGDSEKHMIEANPDAEYYTWKKAELNDETKARVAAYWCNEDELEGKPIAD
SKVFNAH
Download sequence
Identical sequences D0NFW0
XP_002901771.1.21288 PITG_10979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]