SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002914348.1.58354 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002914348.1.58354
Domain Number 1 Region: 1-59
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.57e-23
Family HkH motif-containing C2H2 finger 0.0000641
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002914348.1.58354
Sequence length 159
Comment PREDICTED: U1 small nuclear ribonucleoprotein C [Ailuropoda melanoleuca]; AA=GCF_000004335.2; RF=representative genome; TAX=9646; STAX=9646; NAME=Ailuropoda melanoleuca; AL=Scaffold; RT=Minor
Sequence
MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQG
KIPPTPFSAPPPAGAMIPPPPSLPGPPRPGMMPAPHMGGPPMMPMMGPPPPGMMPVGPAP
GMRPPMGGHMPMMPGPPMMRPPARPMMVPTRPGMTRPDR
Download sequence
Identical sequences A0A096NHM1 A0A0P6JIS2 A0A1S3ACK5 A0A1U7U8E1 A0A250YAJ4 A0A2I3HAU6 A0A2J8Y372 A0A2K5C450 A0A2K5HXY8 A0A2K5MHC4 A0A2K5UXP4 A0A2K5YV19 A0A2K6C1C5 A0A2K6EIH0 A0A2K6LV44 A0A2K6R3J8 A0A2K6UF13 E2RGI3 F1RZ16 F6TFD9 F6XG37 G1U072 G3R9U4 G3TBG7 H0VCM4 I0FUG1 I3MLP3 K7CKJ6 P09234 Q32PA0 Q5TAL4 W5PMC7
ENSOCUP00000022750 ENSSSCP00000001662 ENSP00000244520 ENSBTAP00000034056 ENSOARP00000011602 ENSBTAP00000034056 gi|4507127|ref|NP_003084.1| ENSSSCP00000001662 ENSMMUP00000001162 9606.ENSP00000244520 9823.ENSSSCP00000001662 9913.ENSBTAP00000034056 9986.ENSOCUP00000022750 ENSCJAP00000028223 ENSLAFP00000011319 ENSOCUP00000022750 ENSP00000244520 ENSLAFP00000011319 NP_001177132.1.46622 NP_001300792.1.84170 NP_003084.1.87134 NP_003084.1.92137 XP_001171894.1.37143 XP_001498478.1.31192 XP_002714665.1.1745 XP_002746505.1.60252 XP_002914348.1.58354 XP_003278870.1.23891 XP_003421075.1.64505 XP_003473746.2.53824 XP_003808583.1.60992 XP_003923221.1.74449 XP_003986090.1.62641 XP_004018812.1.66739 XP_004043907.1.27298 XP_004267750.1.21590 XP_004321437.1.83887 XP_004389892.1.4749 XP_004407789.1.74151 XP_004424300.1.5094 XP_004462065.1.11602 XP_004590351.1.84141 XP_004617701.1.94378 XP_004624270.1.9945 XP_004673462.1.23501 XP_004770721.1.14098 XP_004846791.1.39548 XP_005318842.1.77405 XP_005696300.1.57651 XP_005888346.1.15283 XP_005979804.1.78601 XP_006050417.1.26621 XP_006104777.1.53796 XP_006180545.1.101512 XP_006202155.1.17985 XP_006737123.1.47382 XP_006860446.1.41390 XP_006907416.1.64745 XP_007085351.1.5354 XP_007106352.1.24612 XP_007106353.1.24612 XP_007198068.1.59432 XP_007467296.1.90284 XP_007532851.1.11023 XP_007937551.1.48129 XP_007971070.1.81039 XP_008065008.1.4292 XP_008150223.1.99482 XP_008520948.1.77740 XP_008691632.1.72690 XP_010351262.1.97406 XP_010351786.1.97406 XP_010381537.1.97406 XP_010387909.1.97406 XP_010603623.1.5607 XP_010846933.1.44457 XP_010947356.1.22495 XP_010992818.1.51371 XP_011967399.1.54773 XP_012317055.1.9421 XP_012369288.1.9945 XP_012370658.1.9945 XP_012502099.1.63892 XP_012660307.1.62490 XP_013372425.1.28644 XP_014701765.1.49734 XP_015343065.1.40921 XP_015353080.1.40921 XP_016002429.1.101085 XP_016079240.1.3490 XP_017518593.1.32401 XP_019312368.1.44245 XP_019594294.1.88060 XP_019841190.1.53367 XP_020019681.1.5219 XP_020744359.1.74333 XP_021540266.1.83697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]