SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002919043.1.58354 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002919043.1.58354
Domain Number 1 Region: 2211-2304
Classification Level Classification E-value
Superfamily C-type lectin-like 7.53e-32
Family Link domain 0.00012
Further Details:      
 
Domain Number 2 Region: 508-647
Classification Level Classification E-value
Superfamily FAS1 domain 1.7e-30
Family FAS1 domain 0.0021
Further Details:      
 
Domain Number 3 Region: 1475-1523,1601-1715
Classification Level Classification E-value
Superfamily FAS1 domain 3.53e-29
Family FAS1 domain 0.0023
Further Details:      
 
Domain Number 4 Region: 1716-1870
Classification Level Classification E-value
Superfamily FAS1 domain 6.15e-25
Family FAS1 domain 0.0054
Further Details:      
 
Domain Number 5 Region: 965-1122
Classification Level Classification E-value
Superfamily FAS1 domain 1.44e-22
Family FAS1 domain 0.0045
Further Details:      
 
Domain Number 6 Region: 386-501
Classification Level Classification E-value
Superfamily FAS1 domain 6.15e-20
Family FAS1 domain 0.006
Further Details:      
 
Domain Number 7 Region: 2302-2465
Classification Level Classification E-value
Superfamily FAS1 domain 6.8e-17
Family FAS1 domain 0.0086
Further Details:      
 
Domain Number 8 Region: 1141-1210
Classification Level Classification E-value
Superfamily FAS1 domain 0.0000017
Family FAS1 domain 0.0094
Further Details:      
 
Domain Number 9 Region: 1547-1584
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000203
Family Merozoite surface protein 1 (MSP-1) 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002919043.1.58354
Sequence length 2574
Comment PREDICTED: stabilin-1 [Ailuropoda melanoleuca]; AA=GCF_000004335.2; RF=representative genome; TAX=9646; STAX=9646; NAME=Ailuropoda melanoleuca; AL=Scaffold; RT=Minor
Sequence
MAGPRGLLLLCLLAFCLAGSGFTRGQKVRSRRCDVKTKFVTRLPCTMCPAIKRRMCPPGW
LRELPEKISQDCRYEVQLGDSLMSMSGCSLSCWKDVVEKACCPGYWGSQCYECPGGAETP
CNGHGTCLDGIDGNGTCVCQENFGGSACQECQDPNRFGPNCQSVCSCVHGVCSRGPLGNG
SCVCFAGYTGPLCDQELPVCRALNCPQNSQCSAEAPACSCLPGHTQQGRECRAPNPCQPS
PCSPLAQCSVSPSGQAQCRCPKDYHGDGTVCLPQDPCTINYGGCPSNSTLCLYQRPGKAS
CMCKPGLVSVNHNASAGCLAYCFPHSCDRSATCQVTPDGKTSCVCKEGEVGDGRACYGHL
LHEIQKAGQLGVVFLRLRVSLAMLDQGCREILTTSGPFTVLVPSLSSISSRTMNVSLARQ
LCKQHIVAGQHMLEEPGTQQTRRWWTLAGQEIMVTFNRFTKYTYKYNEHPQQTFAIHKTN
YPAANGVFHLVTALQWQPPPELPEDPKKTIGQILASTEAFSRFETILENCGLPSILDGPG
PFTVFVPSNEAVDKLRDGRLIYLFTAGLSKLQELVKYHIYSHGQLTIEKLISKARVLTMA
NQVLAVNISEEGRILLGPEGVPLQRVDVLASNGVIHMLEGVLLPPTILPILPKHCSEEQH
QIVAGSCVDCQALNTSTCPPNSVKLDIFPNECVYTHDPTGLNVLKKGCAHYCNQTVLKPG
CCKGFFGPDCAQCPGGFSNPCYGKGNCSDGVRGNGACLCFPDYKGIACHICSNPNKHGDQ
CQEDCGCVHGLCDNRPGSGGVCQQGTCAPGFSGRFCNESIGNCGPTERAQNCHLHARCVS
QGGVTRCLCLDGFEGDGFSCTPSNPCSHPDRGGCSENAECVPGALGTHHCTCHKGWSGDG
RVCVAIDECELDARGGCHADALCSYVGPGQSRCTCKLGFAGDGYECSPIDPCRAGNGGCH
DLATCQAVGGGQRVCTCPSGYGGDGFSCYGDIFRELEANAHFSVFYQWIKSAGVTLPTDS
RVTALVPSESAIRRLSPDDQAFWLQPRALPRLVRAHFLQGAFSEEELARLGGQHVATLSP
ITRWEIHNISGRVLVQNASVDVADLLATNGVLHVISQVLLPPRGGVLPKQGLLQQLDLVP
AFRLFGELLQHHKLVPQIEAATAYTIFVPTNRSLEAQGNGSSLDEDTVRHHVILGEALSA
EALQRGGHRNSLPRWWCWGMDSTSHLTPQPEVNHVLLEGPVLEAPGRSLFGLSGVLSVGS
SRCLHSHAESLREKCVNCSRRFRCTQGFQLENTPKKSCVYRSGYSFSRGCSYTCAKRIQV
PDCCPGFFGTLCEPCPGGQGGVCSGHGQCQDRLLGSGECRCHEGFHGTACEMCELGRYGP
NCAGVCDCAHGLCQEGLQGDGSCVCNVGWQGPRCDQKITGPQCPKKCDPNANCVQASMAA
PACVCAAGYSGDGIYCSELDPCAQDRGGCSPHANCTKVAPGQRTCTCQDGYAGDGELCQE
VNGCLIRHGGCHTHADCIPTGPQQVSCSCREGYSGDGIRTCVLLDPCSQNNGGCSPYAVC
KSTGDGQRTCTCDAAHTVGDGFTCRARVGLELLRDRHASFFSLHLLEYKELKGDGPFTVF
VPRADLMTNLSQDELARIRAHRQLVFRYHVVGCRQLSSQELLEEGYVTTLSGHPLRIHER
EGSIYLNDFARVVSSDHEAMNGVLHFIDRVLLPPDALHWEPDAAPVLRRNVTAAAEGFGY
KIFSSLVKVAGLLPLLQDASHRPLTMLWPTDSALQALPPDRQVWLYHEDHRDKLAAILRG
HVIRNVEALASDLPNLGPLRTMHGTPISFSCSRARPGELTVGEDEARIVQRHLPFEGGLA
YGIDQLLEPPGLGARCDRFETRPLGLKICSICGLEPPCPEGSREQGSPEACWRYYSKFWT
SPPLHSLALRSIWARSSLWGQPQGLGRGCHRNCVTTTWKPSCCPGHYGSECRACPGGASS
PCSSHGVCMDGMSGSGQCQCHTRFTGTACELCAPGAFGPQCEACRCTSHGRCDEGLGGSG
SCFCEEGWTGPSCEVQLKLQPVCAPPCAPQAVCRANNSCECGLGYEGDGRTCTVADLCQD
GHGGCSEHANCSQVGTVVTCACLPAYEGDGWSCQARDPCADGRRGGCSEHADCLSTGPNT
RRCVCHAGYVGDGLQCLEEPEPPVDRCLGQPPPCHVDAVCADLHFQEKQAGVFHLQAPSG
TYGLNFSEAEAACGAQGAVLASLPQLSAAQKLGFHQCLMGWLANGSAAHPVVFPAADCGG
GQVGVVSLGARKNRSESWDAYCYREQDVACRCRHGFVGDGTSVCNGKLLDVLAATANFST
FYGMLLGYANATPRGLDFLDFLDDELTYKTLFVPVNEGFLDNMTLSGPDLELHASNTTFL
STNASQDTVLPAHSGLSLVFSAVGPDNSSWAPVAPGAVVVSHVVVWDIMAFNGIIHALAR
PLLAPQQPRAVVAPEAPPVVAGVGAVVAAGALLGLTAGAFYLRARGKATGFGFSTFQAED
DAEEDFSPWQEGTSPTLVSVPNPVFGSHDAFCEPFDDSLLEDDFPDTQRILAVK
Download sequence
Identical sequences XP_002919043.1.58354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]