SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002924941.1.58354 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002924941.1.58354
Domain Number 1 Region: 34-125
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.92e-37
Family SCAN domain 0.0000357
Further Details:      
 
Domain Number 2 Region: 471-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.78e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 584-641
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.19e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 630-682
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.27e-18
Family Classic zinc finger, C2H2 0.0023
Further Details:      
 
Domain Number 5 Region: 434-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.41e-18
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 513-559
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000303
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 7 Region: 211-267
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000157
Family KRAB domain (Kruppel-associated box) 0.0054
Further Details:      
 
Domain Number 8 Region: 376-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000106
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002924941.1.58354
Sequence length 684
Comment PREDICTED: zinc finger protein 263 isoform X1 [Ailuropoda melanoleuca]; AA=GCF_000004335.2; RF=representative genome; TAX=9646; STAX=9646; NAME=Ailuropoda melanoleuca; AL=Scaffold; RT=Minor
Sequence
MASGPGSQDREGLLIVKLEEDCAWSQELPPPDPGPSPEASHLRFRRFRFQEAAGPREALS
RLQELCHEWLRPELRTKEQILELLVLEQFLTILPQEIQSRVQELHPESGEEAVALVEDMQ
RELGRLRLQVTNHRRGTEVLLEEPLPLETARESPSFKLEPMETERSPGPRLQELLGPSPK
RDPQAVKERALSAPWLSLFPAEGNMEDKEMTGPQLPESLEDVAMYISQEEWGHQDPSKRA
HSRDTVQESYENVDSLESQVPSQEALSTQVEQGGNPWDPSVQTCKEGLRPRSPAPGEEKF
ENEEESAQSVSPESIHPQALLPGQARGEVPWSPEQGTPRDRAEGHWEPPPEEGMEPSLVG
ATSCRELGRPKELQPRKLHLCPLCGKNFSNNSNLIRHQRIHAAERLCMGVECGEIFGGNP
HFLSLHRAHLGEEAHKCLECGKSFSQNTHLTRHQRTHTGEKPYQCTVCGKSFSCNSNLHR
HQRTHTGEKPYKCPECGEIFAHSSNLLRHQRIHTGERPYKCAECGKSFSRSSHLVIHERT
HEKERLYPFSECGEAVSDSTLFLTNHGTHKAEKKLFECLTCGKSFRQGMHLTRHQRTHTG
EKPYKCNLCGENFSHRSNLIRHQRIHTGEKPYTCHECGDSFSHSSNRIRHLRTHTGERPY
KCSECGESFSRSSRLMSHQRTHTG
Download sequence
Identical sequences D2HQZ6
ENSAMEP00000011164 ENSAMEP00000011164 XP_002924941.1.58354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]