SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002933661.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002933661.1.99540
Domain Number 1 Region: 34-277
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.51e-71
Family Nuclear receptor ligand-binding domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002933661.1.99540
Sequence length 278
Comment PREDICTED: nuclear receptor subfamily 0 group B member 1 [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
MACLDKCHCAVDNRKHGSILYNILKNEEHKESHNSNPRKGNHTGVYGQGCSCGAQKKVSL
KSPQVTCKAASAVLVKTLRFVKNVPCFQELPLDDQMLLVRSCWAPLLVLGLAQDKVDFET
VETSEPSMLQRILTTRQDGEKKQSQQDSLLGSPQHKLSQLPSAAEIRWIKEFLDKCWNLD
ISTKEYAYLKGIVLFNPELPGLHCIQYIQGLQHEAQQALNEHVKMIHRWEQTRFTKLIIV
LSFLRTVNANAIAELFFRPIIGSVNMDDMLLEMLGAKI
Download sequence
Identical sequences F6ZB97
8364.ENSXETP00000033589 XP_002933661.1.99540 ENSXETP00000033589 gi|301608183|gb|XP_002933661| ENSXETP00000033589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]