SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002934153.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002934153.1.99540
Domain Number 1 Region: 42-101
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.52e-17
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 2 Region: 181-231
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000709
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 3 Region: 87-132
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000941
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 4 Region: 120-172
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000128
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002934153.1.99540
Sequence length 499
Comment PREDICTED: zinc finger protein PLAG1 isoform X1 [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
MATVIPGDLSEIRDTQTVPSGKRKRGETKPRKNFPCQLCEKAFNSVEKLKVHSYTHTGER
PYKCTQQDCTKAFVSKYKLLRHMATHSPEKTHKCNYCEKMFHRKDHLKNHLHTHDPNKEA
FKCEECGKNYNTKLGFKRHLALHAATSGDLTCKVCLQTFESTVVLLEHLKTHAGKSSSGV
KEKKHQCEHCDRRFYTRKDVRRHMVVHTGRKDFLCQYCAQRFGRKDHLTRHMKKSHNQEL
LKVKTEPMDLLDHFTCGVPIKDELLPVMSLSSSELTSKPFTNSLQLNLYNTQIQSMQSSA
TTHQMVAPTLSLGMPCPIDMDPVHSSHHLSLKYPLNSTSYAVSMPEKEQPLKGEIESYLM
ELQSGMPPSSQDSPSSSSKLGMNPQVGPLDDGSDGVSLSKSSVSISEPLNASSLDFNQLF
NFIPANGPPYNVPASVGNLGMGYSSEEAHSSMPQLPPQPQDPQDPSNNLCFGSLHPLSSA
FTSSLSTTTTLPRFHQAFQ
Download sequence
Identical sequences F6YT08
8364.ENSXETP00000012477 ENSXETP00000012477 XP_002934153.1.99540 XP_004915248.1.99540 XP_017950609.1.99540 gi|301609201|gb|XP_002934153| ENSXETP00000012477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]