SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002935659.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002935659.1.99540
Domain Number 1 Region: 27-74
Classification Level Classification E-value
Superfamily Elafin-like 0.000000034
Family Elafin-like 0.001
Further Details:      
 
Domain Number 2 Region: 76-122
Classification Level Classification E-value
Superfamily Elafin-like 0.000000785
Family Elafin-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002935659.1.99540
Sequence length 130
Comment PREDICTED: WAP four-disulfide core domain protein 2-like isoform X2 [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
mkvalclfaallvklactqestnttapqgdkagvcpdtnlslgicgkecktdtdcdsnlk
ccktgcdglqclepdekpgscpkpsnqtscettadcksdskceghlkccptgcggyachl
pielkeisat
Download sequence
Identical sequences gi|301612308|gb|XP_002935659| XP_002935659.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]