SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002938349.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002938349.1.99540
Domain Number 1 Region: 228-495
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.05e-79
Family Protein kinases, catalytic subunit 0.0000000615
Further Details:      
 
Domain Number 2 Region: 124-267
Classification Level Classification E-value
Superfamily SH2 domain 2.69e-38
Family SH2 domain 0.0000377
Further Details:      
 
Domain Number 3 Region: 47-171
Classification Level Classification E-value
Superfamily SH3-domain 1.17e-22
Family SH3-domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002938349.1.99540
Sequence length 517
Comment PREDICTED: tyrosine-protein kinase FRK [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
mgnccrkncsclscvlpcvfkeekrsgsnsfngiviqnpvittqldgpqvpprfvnqgeq
qrnsyvalysyegrtpdelsfkagdqmliidtthaswwkakllrtrgkaegyvpfnyvap
vssiesmpwffkdikrseaerllvrpgnttgsfliresesqkgeyslsvfdgiavkhyrl
rklddggfyitskskfvsmnelveyygkreeglcckllkpcittgiplppdlcyhtadhw
einrnslkflkklgqgqfgevweglwnntipvaiktlktgtmnpqdflreaqfmknlrhp
kliqlqavctleepvyiitelmrhgsllsylqndngtsihipnqvdmaaqvasgmaylet
qsfihrdlaarnvlvgengvykvadfglarvfkgedvyeakndtklplkwtapeairynr
ftiksdvwafgilifeivtygkmpypgltgrqaldklengyripkpfncphdlykimlec
wnakpeerptfetlqwkledyfetdpssyleannfer
Download sequence
Identical sequences gi|301617857|gb|XP_002938349| XP_002938349.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]