SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002938358.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002938358.1.99540
Domain Number 1 Region: 70-144
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000694
Family HLH, helix-loop-helix DNA-binding domain 0.0028
Further Details:      
 
Domain Number 2 Region: 154-192
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000301
Family Hairy Orange domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_002938358.1.99540
Sequence length 384
Comment PREDICTED: class E basic helix-loop-helix protein 40 isoform X2 [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
mpltgiytptcsiakaqtlrlpttldcameripsaqpacldrppslsgmdfshmypvfkh
rkalkrceeskdtyklphrliekkrrdrineciaqlkdllpehlklttlghlekavvlel
tlkhvrslsslieqqqqqiltlqsgspseenrisaeemfhsgfqlcaeealrflqggerk
elvahlhrvasklgpasfpkvtekpvpkvqatncvpvicraaplpsgeqsgtdtdtdsgy
ggeadkgechhegtekeeaptleriikqekdeipkkkprmeateeetrfcsdlsslgvyp
aqpplclpfylippsastylpmlekywypgsvpmiyppishssllnqdtskpqhtspqtv
spldssallqalkqmptlgtepkd
Download sequence
Identical sequences XP_002938358.1.99540 gi|301617886|gb|XP_002938358|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]