SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002938379.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002938379.1.99540
Domain Number 1 Region: 336-401
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000878
Family Complement control module/SCR domain 0.0076
Further Details:      
 
Domain Number 2 Region: 154-214
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000958
Family Complement control module/SCR domain 0.00076
Further Details:      
 
Domain Number 3 Region: 86-153
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000249
Family Complement control module/SCR domain 0.0038
Further Details:      
 
Domain Number 4 Region: 277-333
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000264
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 5 Region: 211-277
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000089
Family Complement control module/SCR domain 0.0067
Further Details:      
 
Weak hits

Sequence:  XP_002938379.1.99540
Domain Number - Region: 26-89
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000104
Family Complement control module/SCR domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002938379.1.99540
Sequence length 421
Comment PREDICTED: coagulation factor XIII B chain-like isoform X2 [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
mgpvgvlvcvlccivvgaqpserkgcgrpviqngrveslyvvgrlksirylcnggyiadk
kgpkseygtakctengydpkprclapcslseedmdangiamalhrvwltspikhgdtasf
rckegyeisdsklldstcsdgvltypnctkpdgcgpppevshgetvedpnkfyehgaavt
ykcqqsytlegkkqiscrngqwddppvckgpcslseeemeanglrldyplwwrsspvkhe
nivsfscvqrydisdssllrvrcndgvvmypkcmklescgpppevplgetvqgqlesygh
gsvmtyrcpqyytlegkqnvtcrngtwdeppacrepckvtckdldeknitwiwpfpikrh
vlhgefilfhclegyetskkdllmvqcqqgrmaipncteqdphaegtphrsdfwqmfkpp
m
Download sequence
Identical sequences XP_002938379.1.99540 gi|301617938|gb|XP_002938379|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]