SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002938688.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002938688.1.99540
Domain Number 1 Region: 151-351
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.15e-53
Family Prokaryotic proteases 0.000000559
Further Details:      
 
Domain Number 2 Region: 366-461
Classification Level Classification E-value
Superfamily PDZ domain-like 6.18e-20
Family HtrA-like serine proteases 0.0014
Further Details:      
 
Domain Number 3 Region: 25-102
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000173
Family Growth factor receptor domain 0.0016
Further Details:      
 
Domain Number 4 Region: 88-134
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000103
Family Ovomucoid domain III-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002938688.1.99540
Sequence length 464
Comment PREDICTED: serine protease HTRA3 [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
mklcawlplcalltllsgatrtgacparcdvsrcpspicpsgyvpdrcncclicaagege
pcgregdppcgdslqckpppgmrglkgscqckhtnpvcandgqtydnlcqlkaasrralq
kghspvvlvqkgacqsghqhpnsprykfnfiadvvekiapavvhielflrhplfgrnvpl
ssgsgfiisdlglivtnahvvsssntvsgrqylkvqlhngdsyeatikdidkksdiatik
iyprkklpvlllghsadlrpgefvvaigspfalqntvttgivstaqrdgkelglrdsdmd
yvqtdaiinygnsggplvnldgevigintlkvaagisfaipsdritkfmtesqdkkykan
ndgkkrfigikmltitpsfaeekklhnpdfpdvtsgiyvhevvpnspaqrggiqdgdiiv
kvngrplvtsgdlheavmnesplllevrrgnddmlfnlepevsm
Download sequence
Identical sequences gi|301618560|gb|XP_002938688| XP_002938688.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]