SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002939311.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_002939311.1.99540
Domain Number - Region: 75-117
Classification Level Classification E-value
Superfamily LysM domain 0.000471
Family LysM domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_002939311.1.99540
Sequence length 292
Comment PREDICTED: lysM and putative peptidoglycan-binding domain-containing protein 4 [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
MRLREGRTHSFQPPSSVHSSLGSHVYTFSNGNAEADSSSEEEFDVTELRARGGEQQRVNG
SREKVGDVILLERAITEDDNLNKLALQYGCKVADIKRVNNLITDQDIYALKTIKIPVKVH
GLLTERGDELNAPQHTPGNASALPEPDQKSLPSPGSGDFTVYFKEIDQNIEAAAQTHDLF
NESFALDSPHHLSTHIQGQKQHSSGADWGLRWWNAVVIMLLVGIVLPVFYIVYFKTQGDS
EDIFSIEGRTNASASLSPHTNTVQSLEQMTQRTSGFSPSILQGSHKLLNPGG
Download sequence
Identical sequences F7B869
ENSXETP00000040687 ENSXETP00000040687 XP_002939311.1.99540 XP_012815036.1.99540 gi|301619881|gb|XP_002939311| 8364.ENSXETP00000040687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]