SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_002940077.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_002940077.1.99540
Domain Number 1 Region: 210-449
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.44e-71
Family Nuclear receptor ligand-binding domain 0.000000000651
Further Details:      
 
Domain Number 2 Region: 7-92
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.85e-31
Family Nuclear receptor 0.0000979
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_002940077.1.99540
Sequence length 458
Comment PREDICTED: nuclear receptor ROR-beta [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
mraqievipckicgdkssgihygvitcegckgffrrsqqnnasyscprqrnclidrtnrn
rcqhcrlqkclalgmsrdavkfgrmskkqrdslyaevqkhqqrlqeqrqqqsgeaealar
vyssnisnglsnlnndtggtyanghvidlpkseyysvdsaqpspdqsgidmtgmkqikqe
piydltsvpnlfmyssfnngqmspgismseidrvaqniikshletcqytvdelhqlawqt
htyeeikiyqnksrealwqqcaiqithaiqyvvefakritgfmelcqndqilllksgcle
vvivrmcrafnplnntvlfegkyggmqmfkslgsddfvneafdfakslcslqlteeeial
fsaavlisperpwlieprkvqklqeriyfalqhviqknhlddetlakliakipnitalcn
lhgeklqvfkqthpeivntlfpplykelfnpdsstsck
Download sequence
Identical sequences gi|301621480|gb|XP_002940077| XP_002940077.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]